PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010543616.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 245aa    MW: 28220.7 Da    PI: 8.4318
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010543616.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.52.3e-11106150347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+ l++ +  ++G g+W++I+r +   Rt+ q+ s+ qky
   XP_010543616.1 106 PWTENEHRLFLIGLGKYGRGDWRSISRNVVVSRTPTQVASHAQKY 150
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.586151IPR017877Myb-like domain
SMARTSM007171.3E-4253IPR001005SANT/Myb domain
SuperFamilySSF466893.66E-10458IPR009057Homeodomain-like
PROSITE profilePS5129419.24899155IPR017930Myb domain
SuperFamilySSF466891.38E-15100155IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-16102154IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.7E-10103149IPR009057Homeodomain-like
SMARTSM007172.9E-8103153IPR001005SANT/Myb domain
PfamPF002493.7E-9106150IPR001005SANT/Myb domain
CDDcd001675.13E-7106151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDANYWTRTE DKMFEEALVT FSELMPDRWQ RISEILRRSQ SEVYDHYYAL VHDVSEIDSG  60
RVNVPAYADH SPASCDSPAT VAATRTTPKS LRVKRDGTEK KKKGTPWTEN EHRLFLIGLG  120
KYGRGDWRSI SRNVVVSRTP TQVASHAQKY FLRQAQIDKE RKRASIHDLT TVDNDDILQW  180
NTLQPQPQPQ SQPPLQQPQP QPQVLQPLPL LSMNQQFMLV QGHAQLPPRD YQSLGQFPGD  240
LDFRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010543616.10.0PREDICTED: transcription factor DIVARICATA-like isoform X2
TrEMBLD7LXM52e-74D7LXM5_ARALL; Putative uncharacterized protein
STRINGscaffold_600421.15e-74(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-69MYB family protein